discontinued

H00011082-D01 ESM1 antibody

See related secondary antibodies

Search for all "ESM1"

Quick Overview

Rabbit anti Human ESM1

H00011082-D01

More Views

  • H00011082-D01

Product Description for ESM1

Rabbit anti Human ESM1.
Presentation: Serum
Product is tested for ELISA (detection), Immunoprecipitation, Western blot / Immunoblot.

Properties for ESM1

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Endocan, Endothelial cell-specific molecule 1
Presentation Serum
Reactivity Hu
Applications E(detection), IP, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQ30
Immunogen:
ESM1 (NP_008967.1, 1 a.a. ~ 184 a.a) full-length human protein.
AA Sequence:
MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMK CGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEH DMASGDGNIVREEVVKENAAGSPVMRKWLNPR
GeneID:
11082
Remarks:
Gene Accession: NM_007036.3
Add. information Rabbit polyclonal antibody raised against a full-length human ESM1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IP,WB-Ti
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 11082

Accessory Products

Proteins and/or Positive Controls

Proteins for ESM1 (8 products)

Catalog No. Species Pres. Purity   Source  

ESM1 (transcript variant 1)

ESM1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €139.00
  OriGene Technologies, Inc.

ESM1 (20-184, His-tag)

ESM1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

ESM1 (20-184, His-tag)

ESM1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

ESM1 (His-tag)

SDS-PAGE analysis of recombinant human Endocan / ESM1 derived from insect cells Cat.-No. AR60002PU-N. Sample was loaded in 15% SDS-polyacrylamide gel under non-reducing conditions and stained with Coomassie blue. Human Purified > 95 % by SDS-PAGE and Silver staining Insect cells
50 µg / €350.00
  OriGene Technologies GmbH

ESM1

ESM1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ESM1

ESM1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ESM1

ESM1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ESM1

ESM1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ESM1 (4 products)

Catalog No. Species Pres. Purity   Source  

ESM1 293T Cell Transient Overexpression Lysate(Denatured)

ESM1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ESM1 Lysate

Western Blot: ESM1 Lysate [NBL1-10343] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ESM1
  Novus Biologicals Inc.

ESM1 overexpression lysate

ESM1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ESM1 overexpression lysate

ESM1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn