discontinued

H00002100-D01P Estrogen receptor beta antibody

See related secondary antibodies

Search for all "Estrogen receptor beta"

Quick Overview

Rabbit anti Human Estrogen receptor beta

Product Description for Estrogen receptor beta

Rabbit anti Human Estrogen receptor beta.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Estrogen receptor beta

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms ER-beta, ESR2, ESTRB, NR3A2, Nuclear receptor subfamily 3 group A member 2
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92731
Immunogen:
ESR2 (AAH24181.1, 1 a.a. ~ 323 a.a) full-length human protein.
AA Sequence:
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSP NVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVC SDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRL VRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADK ELVHMISWAKKIPGMRGNA
GeneID:
2100
Remarks:
Gene Accession: BC024181.2
Add. information Rabbit polyclonal antibody raised against a full-length human ESR2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 2100

Accessory Products

Proteins and/or Positive Controls

Proteins for Estrogen receptor beta (6 products)

Catalog No. Species Pres. Purity   Source  

Estrogen receptor beta (full length, C-term DDK tag)

Estrogen receptor beta Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €399.00
  OriGene Technologies, Inc.

Estrogen receptor beta

Estrogen receptor beta Human
  Abnova Taiwan Corp.

Estrogen receptor beta

Estrogen receptor beta Human in vitro transl.
  Abnova Taiwan Corp.

Estrogen receptor beta

Estrogen receptor beta Human in vitro transl.
  Abnova Taiwan Corp.

Estrogen receptor beta

Estrogen receptor beta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Estrogen receptor beta

Estrogen receptor beta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Estrogen receptor beta (1 products)

Catalog No. Species Pres. Purity   Source  

Estrogen Receptor beta Lysate

Western Blot: Estrogen Receptor beta Lysate [NBL1-10345] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ESR2
  Novus Biologicals Inc.
  • LinkedIn