discontinued

H00002100-M01 Estrogen receptor beta antibody

See related secondary antibodies

Search for all "Estrogen receptor beta"

Quick Overview

Mouse anti Human Estrogen receptor beta 3F3

Product Description for Estrogen receptor beta

Mouse anti Human Estrogen receptor beta 3F3.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Estrogen receptor beta

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms ER-beta, ESR2, ESTRB, NR3A2, Nuclear receptor subfamily 3 group A member 2
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3F3
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92731
Immunogen:
ESR2 (NP_001428, 22 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
ILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSH LYAEPQKSPWCEARSLEHTLPVNR*
GeneID:
2100
Remarks:
Gene Accession: NM_001437
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant ESR2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 2100

Accessory Products

Proteins and/or Positive Controls

Proteins for Estrogen receptor beta (6 products)

Catalog No. Species Pres. Purity   Source  

Estrogen receptor beta (full length, C-term DDK tag)

Estrogen receptor beta Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €399.00
  OriGene Technologies, Inc.

Estrogen receptor beta

Estrogen receptor beta Human
  Abnova Taiwan Corp.

Estrogen receptor beta

Estrogen receptor beta Human in vitro transl.
  Abnova Taiwan Corp.

Estrogen receptor beta

Estrogen receptor beta Human in vitro transl.
  Abnova Taiwan Corp.

Estrogen receptor beta

Estrogen receptor beta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Estrogen receptor beta

Estrogen receptor beta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Estrogen receptor beta (1 products)

Catalog No. Species Pres. Purity   Source  

Estrogen Receptor beta Lysate

Western Blot: Estrogen Receptor beta Lysate [NBL1-10345] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ESR2
  Novus Biologicals Inc.
  • LinkedIn