TA341509 ESX1 antibody

Rabbit Polyclonal Anti-ESX1 Antibody

See related secondary antibodies

Search for all "ESX1"

0.1 mg / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ESX1

Product Description for ESX1

Rabbit anti Human ESX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ESX1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms ESX1L, ESX1R, Homeobox protein ESX1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ESX1 antibody: synthetic peptide directed towards the N terminal of human ESX1. Synthetic peptide located within the following region: SLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDREGGGGHEPEQ.
Application WB
Background This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-termil fragment with a paired-like homeodomain and a 20 kDa C-termil fragment with a proline-rich domain.The C-termil fragment localizes toThe cytoplasm whileThe N-termil fragment localizes exclusively toThe nucleus. In contrast to human,The mouse homolog has a novel PN/PF motif inThe C-terminus and is paterlly imprinted in placental tissue.This gene likely plays a role in placental development and spermatogenesis. [provided by RefSeq, Jan 2010].
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ESX1 (2 products)

Catalog No. Species Pres. Purity   Source  


ESX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


ESX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn