discontinued

H00002114-B01P ETS2 antibody

See related secondary antibodies

Search for all "ETS2"

Quick Overview

Mouse anti Human ETS2

Product Description for ETS2

Mouse anti Human ETS2.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for ETS2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Protein C-ets-2
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P15036
Immunogen:
ETS2 (NP_005230.1, 1 a.a. ~ 469 a.a) full-length human protein.
AA Sequence:
MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPLLTPCSK AVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAP DFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPS VLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQSSLLD VQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQS FISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEE LHAILGVQPDTED
GeneID:
2114
Remarks:
Gene Accession: NM_005239.4
Add. information Mouse polyclonal antibody raised against a full-length human ETS2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 2114

Accessory Products

Proteins and/or Positive Controls

Proteins for ETS2 (9 products)

Catalog No. Species Pres. Purity   Source  

ETS2 (full length, N-term HIS tag)

ETS2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

ETS2 (1-469, His-tag)

ETS2 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

ETS2 (1-469, His-tag)

ETS2 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

ETS2 (298-400, His-tag)

ETS2 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €940.00
  Acris Antibodies GmbH

ETS2 (298-400, His-tag)

ETS2 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €370.00
  Acris Antibodies GmbH

ETS2

ETS2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ETS2

ETS2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ETS2

ETS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ETS2

ETS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ETS2 (3 products)

Catalog No. Species Pres. Purity   Source  

ETS2 293T Cell Transient Overexpression Lysate(Denatured)

ETS2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ETS2 Lysate

Western Blot: ETS2 Lysate [NBL1-10356] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ETS2
  Novus Biologicals Inc.

ETS2 overexpression lysate

ETS2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn