TA343521 ETS2 antibody

Rabbit Polyclonal Anti-ETS2 Antibody

See related secondary antibodies

Search for all "ETS2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish ETS2


More Views

  • TA343521

Product Description for ETS2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish ETS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ETS2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Protein C-ets-2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the middle region of human ETS2. Synthetic peptide located within the following region: DPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC.
Application WB
Background ETS2 contains an ETS D-binding domain and belongs to the ETS family. ETS2 is a target of protein kise C and upregulates GM-CSF. Ets2 and its targets play essential roles in endothelial cell function. Coexpression of Ets-2 and SRC-1 significantly associated with the rate of recurrence and HER expression in breast cancer. Overexpression of ETS2 is associated with human esophageal squamous cell carcinoma. ETS transcriptions factors, such as ETS2, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix D-binding domain that recognizes the core consensus D sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ETS2 (9 products)

Catalog No. Species Pres. Purity   Source  

ETS2 (full length, N-term HIS tag)

ETS2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

ETS2 (1-469, His-tag)

ETS2 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

ETS2 (1-469, His-tag)

ETS2 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

ETS2 (298-400, His-tag)

ETS2 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €940.00
  OriGene Technologies GmbH

ETS2 (298-400, His-tag)

ETS2 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €370.00
  OriGene Technologies GmbH


ETS2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


ETS2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


ETS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


ETS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ETS2 (3 products)

Catalog No. Species Pres. Purity   Source  

ETS2 293T Cell Transient Overexpression Lysate(Denatured)

ETS2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ETS2 Lysate

Western Blot: ETS2 Lysate [NBL1-10356] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ETS2
  Novus Biologicals Inc.

ETS2 overexpression lysate

ETS2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn