NBP1-55430 EXOC6 antibody

See related secondary antibodies

Search for all "EXOC6"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human EXOC6

Product Description for EXOC6

Rabbit anti Human EXOC6.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for EXOC6

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp761I2124, EXOC6A, FLJ1125, FLJ11251, MGC33397, SEC15L, SEC15L1, SEC15L3, Sec15p
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B3KXY5
Immunogen:
Synthetic peptides corresponding to EXOC6(exocyst complex component 6) Antibody(against the N terminal of EXOC6. Peptide sequence MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI.
GeneID:
54536
Background The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 54536

Accessory Products

  • LinkedIn