NBP1-57285 EXOSC7 antibody

See related secondary antibodies

Search for all "EXOSC7"

50 µg / €390.00

Quick Overview

Rabbit anti Human, Mouse EXOSC7

Product Description for EXOSC7

Rabbit anti Human, Mouse EXOSC7.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for EXOSC7

Product Category Primary Antibodies
Quantity 50 µg
Synonyms EAP1, FLJ26543, KIAA0116, RRP42, Rrp42p, hRrp42p, p8
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to EXOSC7(exosome component 7) The peptide sequence was selected from the N terminal of EXOSC7. Peptide sequence EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC.
Background EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. The protein is required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 23016

Accessory Products

  • LinkedIn