discontinued

H00002131-D01P Exostosin-1 antibody

See related secondary antibodies

Search for all "Exostosin-1"

Quick Overview

Rabbit anti Human Exostosin-1

Product Description for Exostosin-1

Rabbit anti Human Exostosin-1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Exostosin-1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms EXT1, Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase, Multiple exostoses protein 1, Putative tumor suppressor protein EXT1
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16394
Immunogen:
EXT1 (NP_000118.2, 1 a.a. ~ 746 a.a) full-length human protein.
AA Sequence:
MQAKKRYFILLSAGSCLALLFYFGGLQFRASRSHSRREEHSGRNGLHHPSPDHFWPRFPDALRPFVPWDQLENEDS SVHISPRQKRDANSSIYKGKKCRMESCFDFTLCKKNGFKVYVYPQQKGEKIAESYQNILAAIEGSRFYTSDPSQAC LFVLSLDTLDRDQLSPQYVHNLRSKVQSLHLWNNGRNHLIFNLYSGTWPDYTEDVGFDIGQAMLAKASISTENFRP NFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNGEDVVLLTTCKHGKDW QKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGRRLGSFRFLEALQAACVPVMLSNGWELPFSEVINWNQAAVI GDERLLLQIPSTIRSIHQDKILALRQQTQFLWEAYFSSVEKIVLTTLEIIQDRIFKHISRNSLIWNKHPGGLFVLP QYSSYLGDFPYYYANLGLKPPSKFTAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPAT AVPVVVIEGESKVMSSRFLPYDNIITDAVLSLDEDTVLSTTEVDFAFTVWQSFPERIVGYPARSHFWDNSKERWGY TSKWTNDYSMVLTGAAIYHKYYHYLYSHYLPASLKNMVDQLANCEDILMNFLVSAVTKLPPIKVTQKKQYKETMMG QTSRASRWADPDHFAQRQSCMNTFASWFGYMPLIHSQMRLDPVLFKDQVSILRKKYRDIERL
GeneID:
2131
Remarks:
Gene Accession: NM_000127
Add. information Rabbit polyclonal antibody raised against a full-length human EXT1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 2131

Accessory Products

Proteins and/or Positive Controls

Proteins for Exostosin-1 (5 products)

Catalog No. Species Pres. Purity   Source  

Exostosin-1

Exostosin-1 Human
  Abnova Taiwan Corp.

Exostosin-1

Exostosin-1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Exostosin-1

Exostosin-1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Exostosin-1

Exostosin-1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Exostosin-1

Exostosin-1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Exostosin-1 (2 products)

Catalog No. Species Pres. Purity   Source  

EXT1 Lysate

Western Blot: Exostosin 1 Lysate [NBL1-10391] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for Exostosin 1.
  Novus Biologicals Inc.

EXT1 Lysate

Western Blot: Exostosin 1 Lysate [NBL1-10393] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for Exostosin 1
  Novus Biologicals Inc.
  • LinkedIn