TA330254 EYA3 antibody

Rabbit Polyclonal Anti-EYA3 Antibody

See related secondary antibodies

Search for all "EYA3"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat EYA3

TA330254

More Views

  • TA330254

Product Description for EYA3

Rabbit anti Canine, Human, Mouse, Rat EYA3.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for EYA3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Eyes absent homolog 3
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99504
Immunogen:
The immunogen for anti-EYA3 antibody: synthetic peptide directed towards the middle region of human EYA3.
AA Sequence:
QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA
GeneID:
2140
Application

Western blotting (0.05 - 0.5 µg/ml)
Immunohistochemsitry on paraffin embedded sections (2 - 8 µg/ml)

Background EYA3 is a tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. This protein promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. EYA3 coactivates SIX1, and seems to coactivate SIX2, SIX4 and SIX5. The repression of precursor cell proliferation in myoblasts by SIX1 is switched to activation through recruitment of EYA3 to the SIX1-DACH1 complex and seems to be dependent on EYA3 phosphatase activity.
General Readings Borsani,G., et al., (1999) Hum.Mol.Genet.8(1),38679
Storage Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term. Avoid repeated freezing and thawing. Shelf life: one year from dispatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Lyophilized from PBS
Aff - Purified
Reconstitution:
Add 50 μl of distilled water to a final concentration of 1 mg/ml.
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for EYA3 (2 products)

Catalog No. Species Pres. Purity   Source  

EYA3

EYA3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EYA3

EYA3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn