TA344513 EYA3 antibody

Rabbit Polyclonal Anti-EYA3 Antibody - middle region

See related secondary antibodies

Search for all "EYA3"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep EYA3

Product Description for EYA3

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep EYA3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EYA3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Eyes absent homolog 3
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99504
Immunogen:
The immunogen for Anti-EYA3 antibody is: synthetic peptide directed towards the middle region of Human EYA3. Synthetic peptide located within the following region: YQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKN.
GeneID:
2140
Application WB
Background This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptiol activator and have a role during development. A similar protein in mice acts as a transcriptiol activator.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EYA3 (2 products)

Catalog No. Species Pres. Purity   Source  

EYA3

EYA3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EYA3

EYA3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn