H00283991-B01P FAM100B antibody

See related secondary antibodies

Search for all "FAM100B"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FAM100B

H00283991-B01P

Product Description for FAM100B

Mouse anti Human FAM100B.
Product is tested for Western blot / Immunoblot.

Properties for FAM100B

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC29814, MGC71792
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IYN6
Immunogen:
FAM100B (ABW03765.1, 1 a.a. ~ 164 a.a) full-length human protein.
AA Sequence:
MSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPATPPNFP DALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQPTWPPGAQQGGA QQKAMAAMDGQR
GeneID:
283991
Add. information Mouse polyclonal antibody raised against a full-length human FAM100B protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn