H00158293-B01P FAM120AOS antibody

See related secondary antibodies

Search for all "FAM120AOS"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FAM120AOS

H00158293-B01P

Product Description for FAM120AOS

Mouse anti Human FAM120AOS.
Product is tested for Western blot / Immunoblot.

Properties for FAM120AOS

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C9orf10OS, FLJ31534
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T036
Immunogen:
FAM120AOS (AAI60143.1, 1 a.a. ~ 256 a.a) full-length human protein.
AA Sequence:
MGKTKDIGDDDTVASEFWSGALSQPSSVPTRPRTPNRDSWRRAWAARGLHPRPSILQPGPARLSRARAGGTRCPQR RHGRATFCALGRGIGVRRGPGPRPARIPGLTLTWKRMSARRMQWAMQTGGRNQTFGGGVPLFWTWLTICCAVWRSL PCRLTHSCSRAFSSAPLKKTKSSMLPPKQALASAARNLCRGAGCNRQAVAGQLLPSTWSLHAHGLAKEAPILPVKK ISRSCSVNNKVSKKTTKPPTLRSFLSPI
GeneID:
158293
Add. information Mouse polyclonal antibody raised against a full-length human FAM120AOS protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn