NBP1-93907 FAM123A antibody

See related secondary antibodies

Search for all "FAM123A"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FAM123A

NBP1-93907

More Views

  • NBP1-93907

Product Description for FAM123A

Rabbit anti Human FAM123A.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for FAM123A

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N7J2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VDDTYLQEFWDMLSQTEEQGPEPQEGAAKVAAALETKVVPETPKDTRCVEAAKDASSVKRRRLNRIPIEPHPKEEPKHPEKEQQE
GeneID:
219287
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 219287

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM123A (1 products)

Catalog No. Species Pres. Purity   Source  

Family with sequence similarity 123A (FAM123A), transcript variant 2 (transcript variant 2)

Family with sequence similarity 123A (FAM123A), transcript variant 2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn