NBP1-93800 FAM123C antibody

See related secondary antibodies

Search for all "FAM123C"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FAM123C

Product Description for FAM123C

Rabbit anti Human FAM123C.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for FAM123C

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N944
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YSASTQDQRCRDRVQDLSWLRVEPTGLGVQAWASVEDQPLQLSTEAVEQVAHGSQLDSEPRSAPAARWSSQGHHPESLGLTLNSQQEGGVSASAPEC
GeneID:
205147
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 205147

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM123C (1 products)

Catalog No. Species Pres. Purity   Source  

AMER3 overexpression lysate

AMER3 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn