discontinued

NBP1-93800 FAM123C antibody

See related secondary antibodies

Search for all "FAM123C"

Quick Overview

Rabbit anti Human FAM123C

Product Description for FAM123C

Rabbit anti Human FAM123C.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for FAM123C

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N944
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YSASTQDQRCRDRVQDLSWLRVEPTGLGVQAWASVEDQPLQLSTEAVEQVAHGSQLDSEPRSAPAARWSSQGHHPESLGLTLNSQQEGGVSASAPEC
GeneID:
205147
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 205147

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM123C (1 products)

Catalog No. Species Pres. Purity   Source  

AMER3 overexpression lysate

AMER3 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn