discontinued

NBP1-87937 FAM12B antibody

See related secondary antibodies

Search for all "FAM12B"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human FAM12B

Product Description for FAM12B

Rabbit anti Human FAM12B.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for FAM12B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P56851
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLKMVEPIGN
GeneID:
64184
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 64184

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM12B (1 products)

Catalog No. Species Pres. Purity   Source  

Family with sequence similarity 12, member B (epididymal) (FAM12B)

Family with sequence similarity 12, member B (epididymal) (FAM12B) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.
  • LinkedIn