H00286499-B01P FAM133A antibody

See related secondary antibodies

Search for all "FAM133A"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FAM133A

H00286499-B01P

Product Description for FAM133A

Mouse anti Human FAM133A.
Product is tested for Western blot / Immunoblot.

Properties for FAM133A

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ37659
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N9E0
Immunogen:
FAM133A (NP_775969.1, 1 a.a. ~ 248 a.a) full-length human protein.
AA Sequence:
MGKRDNRVAYMNPIAMARWRGPTQSVGPTIQDYLNRPRPTWEEVKKQLENKKTGSKALAEFEEKMNENWKKELEKS REKLLSGNESSSKKRERKKKRKKKSCRSSSSSSSSDSSSSSSDSEDEEKKQGKRRKKKKNRSYKSSQSSTHESESE SKESVKKKKKSKDETEKEKDVRSLSKKRKKSYPDDKPLSSESSSESDYEEDVQAKKKRRCEEREQAKEKVKKKKKK QHKKHSKKKKKKSGSSHKSR
GeneID:
286499
Add. information Mouse polyclonal antibody raised against a full-length human FAM133A protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM133A (2 products)

Catalog No. Species Pres. Purity   Source  

FAM133A overexpression lysate

FAM133A overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

FAM133A overexpression lysate

FAM133A overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn