discontinued

NBP1-90647 FAM151B antibody

See related secondary antibodies

Search for all "FAM151B"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human FAM151B

Product Description for FAM151B

Rabbit anti Human FAM151B.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for FAM151B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UXP7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MAASAGGPGSWSENILEYFLRNSQITAEDGAEITWYHAANHKAQTNEALKSTAHMIEADVLLPSDGSEHSQPIMAHPPETNSDNTLQEWLTEVMK
GeneID:
167555
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 167555

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM151B (1 products)

Catalog No. Species Pres. Purity   Source  

Family with sequence similarity 151, member B (FAM151B)

Family with sequence similarity 151, member B (FAM151B) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for FAM151B (1 products)

Catalog No. Species Pres. Purity   Source  

FAM151B overexpression lysate

FAM151B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn