NBP1-90647 FAM151B antibody

See related secondary antibodies

Search for all "FAM151B"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FAM151B

Product Description for FAM151B

Rabbit anti Human FAM151B.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for FAM151B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UXP7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MAASAGGPGSWSENILEYFLRNSQITAEDGAEITWYHAANHKAQTNEALKSTAHMIEADVLLPSDGSEHSQPIMAHPPETNSDNTLQEWLTEVMK
GeneID:
167555
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 167555

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM151B (1 products)

Catalog No. Species Pres. Purity   Source  

Family with sequence similarity 151, member B (FAM151B)

Family with sequence similarity 151, member B (FAM151B) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for FAM151B (1 products)

Catalog No. Species Pres. Purity   Source  

FAM151B overexpression lysate

FAM151B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn