H00084067-B01P FAM160A2 antibody

See related secondary antibodies

Search for all "FAM160A2"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FAM160A2

H00084067-B01P

Product Description for FAM160A2

Mouse anti Human FAM160A2.
Product is tested for Western blot / Immunoblot.

Properties for FAM160A2

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C11orf56, DKFZp566M1046, FLJ22665, KIAA1759
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N612
Immunogen:
FAM160A2 (AAH30825.1, 1 a.a. ~ 972 a.a) full-length human protein.
AA Sequence:
MERMNWLSRLASRGPGHRIPQGANLQTPVMADPETCLMVFKNHWSQVVRILERQGPRAAPGGADDLSAVRNHTYQM LTLLAEDRAVPSAPTGPGPLLEFALHEDLLTRVLTWQLQWDELGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVR EALLTLLDACGRPVPSSPALDEGLVLLLSQLCVCVAQEPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQ QARDALLLLMALSAGSPTVGRYIADHSYFCPVLATGLSALYSSLPRKIEVPGDDWHCLRREDWLGVPALALFMSSL EFCNAVIQVAHPLVQKQLVDYIHNGFLVPVMGPALHKTSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHD THTILDTLVARIGSNSRLCMVSLSLFRTLLNLSCEDVLLQLVLRYLVPCNHVMLSQKPAVRDVDLYGRAADKFLSL IPRCCRHHAPSPPRPEHASWARGPGSPSVDSSSVTTVPRPSTPSRLALFLRQQSLGGSESPGPAPCSPGLSASPAS SPGRRPTPAEEPGELEDNYLEYLREARRGVDRCVRACRTWSAPYDGERPSPEPSPFGSRTKKRSLLPEEDRNNVGE GEEEELGRRGRAGGAGEGPGHLPPPQLNGVPGSWPEGAKKVRLVPKEGAGELLEGISEGMAGLEGFGQELRELEVA LSNGGTGSESPLEPPLPLEEEEAYESFTCPPEPPGPFLSSPLRTLNQLPSQPFTGPFMAVLFAKLENMLQNSVYVN FLLTGLVAQLACHPQPLLRSFLLNTNMVFQPSVKSLLQVLGSVKNKIENFAASQEDFPALLSKAKKYLIARGKLDW AEGPAAGPAPRRSDPLVKSRRPSLGELLLRHAHSPTRARQAAQLVLQPGRDGAGLGLSGGSPGASTPVLLTRGGAP ERQGEALRVKNAVYCAVIFPEFLKELAAISQAHAVTSPFLLETSEEGSGPLISGCGPLNP
GeneID:
84067
Add. information Mouse polyclonal antibody raised against a full-length human FAM160A2 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn