H00642968-B01P FAM163B antibody

See related secondary antibodies

Search for all "FAM163B"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FAM163B

H00642968-B01P

Product Description for FAM163B

Mouse anti Human FAM163B.
Product is tested for Western blot / Immunoblot.

Properties for FAM163B

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C9orf166
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P0C2L3
Immunogen:
FAM163B (AAI56626.1, 1 a.a. ~ 166 a.a) full-length human protein.
AA Sequence:
MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKDESEEDEEEPDFAVHSHLPPLHSNRNLVLTNGPALYPTA STSFSQKSPQARALCRSCSHCEPPTFFLQEPPEEEEDVLNGGERVLYKSVSQEDVELPPGGFGGLQALNPNRLSAM REAFARSRSISTDV
GeneID:
642968
Add. information Mouse polyclonal antibody raised against a full-length human FAM163B protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn