NBP1-74067 FAM168A antibody

See related secondary antibodies

Search for all "FAM168A"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse FAM168A

NBP1-74067

Product Description for FAM168A

Rabbit anti Mouse FAM168A.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM168A

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q68FE1
Immunogen:
Synthetic peptides corresponding to the N terminal of Fam168a. Immunizing peptide sequence NSPSYAPATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTYQASSAAFR.
GeneID:
319604
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
State:
Aff - Purified
Gene ID 319604

Accessory Products

  • LinkedIn