discontinued

H00134145-B01P FAM173B antibody

See related secondary antibodies

Search for all "FAM173B"

Quick Overview

Mouse anti Human FAM173B

Product Description for FAM173B

Mouse anti Human FAM173B.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for FAM173B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P4H8
Immunogen:
LOC134145 (NP_954584, 1 a.a. ~ 233 a.a) full-length human protein.
AA Sequence:
MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPFVPATMK QIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFS QYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYDASTFRGREKRPCTSMHFQ LPIQA
GeneID:
134145
Remarks:
Gene Accession: NM_199133
Add. information Mouse polyclonal antibody raised against a full-length human LOC134145 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 134145

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM173B (2 products)

Catalog No. Species Pres. Purity   Source  

FAM173B

FAM173B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FAM173B

FAM173B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FAM173B (2 products)

Catalog No. Species Pres. Purity   Source  

FAM173B 293T Cell Transient Overexpression Lysate(Denatured)

FAM173B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FAM173B Lysate

Western Blot: FAM173B Lysate [NBL1-10498] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FAM173B
  Novus Biologicals Inc.
  • LinkedIn