NBP1-90730 FAM181A antibody

See related secondary antibodies

Search for all "FAM181A"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FAM181A

Product Description for FAM181A

Rabbit anti Human FAM181A.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for FAM181A

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N9Y4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NCKGLEPLGPETTLVSMSPRALAEKEPLKMPGVSLVGRVNAWSCCPFQYHGQPIYPGPLGALPQSPVPSLGLWRKSPAFPGELAHLCKDVDGLGQKVCRPVVLKPIPTKPAVPPPIFNVFG
GeneID:
90050
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 90050

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM181A (1 products)

Catalog No. Species Pres. Purity   Source  

FAM181A overexpression lysate

FAM181A overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn