H00085395-B01P FAM207A antibody

See related secondary antibodies

Search for all "FAM207A"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FAM207A

H00085395-B01P

Product Description for FAM207A

Mouse anti Human FAM207A.
Product is tested for Western blot / Immunoblot.

Properties for FAM207A

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C21orf70, PRED56
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NSI2
Immunogen:
FAM207A (NP_478070.1, 1 a.a. ~ 230 a.a) full-length human protein.
AA Sequence:
MGKVRGLRARVHQAAVRPKGEAAPGPAPPAPEATPPPASAAGKDWAFINTNIFARTKIDPSALVQKLELDVRSVTS VRRGEAGSSARSVPSIRRGAEAKTVLPKKEKMKLRREQWLQKIEAIKLAEQKHREERRRRATVVVGDLHPLRDALP ELLGLEAGSRRQARSRESNKPRPSELSRMSAAQRQQLLEEERTRFQELLASPAYRASPLVAIGQTLARQMQLEDGG QL
GeneID:
85395
Add. information Mouse polyclonal antibody raised against a full-length human FAM207A protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM207A (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 21 open reading frame 70 (C21orf70)

Chromosome 21 open reading frame 70 (C21orf70) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for FAM207A (2 products)

Catalog No. Species Pres. Purity   Source  

C21orf70 Lysate

Western Blot: C21orf70 Lysate [NBL1-08390] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for LY409226. Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

FAM207A overexpression lysate

FAM207A overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn