NBP1-90673 FAM208A antibody

See related secondary antibodies

Search for all "FAM208A"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FAM208A

Product Description for FAM208A

Rabbit anti Human FAM208A.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for FAM208A

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UK61
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVYQKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNIQQRHIVFLTEKNIKMLSSYTDNGIVVATAEDFMQNFKNLVGYHNSITEENLPQLGANENLES
GeneID:
23272
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 23272

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM208A (2 products)

Catalog No. Species Pres. Purity   Source  

FAM208A overexpression lysate

FAM208A overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.

FAM208A overexpression lysate

FAM208A overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn