H00084293-B01P FAM213A antibody

See related secondary antibodies

Search for all "FAM213A"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FAM213A

H00084293-B01P

Product Description for FAM213A

Mouse anti Human FAM213A.
Product is tested for Western blot / Immunoblot.

Properties for FAM213A

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C10orf58, PAMM, PRO2290
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BRX8
Immunogen:
FAM213A (AAH05871.3, 1 a.a. ~ 229 a.a) full-length human protein.
AA Sequence:
MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGAV IMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGEIFLDEKKKFYGPQRRKMMFMG FIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEK K
GeneID:
84293
Add. information Mouse polyclonal antibody raised against a full-length human FAM213A protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn