NBP1-91159 FAM26D antibody

See related secondary antibodies

Search for all "FAM26D"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FAM26D

Product Description for FAM26D

Rabbit anti Human FAM26D.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for FAM26D

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JW98
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LTSLQHCYWTSHLQNERELFEQAAEQHSRLLMMHRIKKLFGFIPGSEDVKHIRIPSCQDWKDISVPTLLCMGDDLQGHYSFLGNRVDEDNEEDRSRGIEL
GeneID:
221301
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 221301

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM26D (1 products)

Catalog No. Species Pres. Purity   Source  

FAM26D overexpression lysate

FAM26D overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn