discontinued

NBP1-91159 FAM26D antibody

See related secondary antibodies

Search for all "FAM26D"

Quick Overview

Rabbit anti Human FAM26D

Product Description for FAM26D

Rabbit anti Human FAM26D.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for FAM26D

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JW98
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LTSLQHCYWTSHLQNERELFEQAAEQHSRLLMMHRIKKLFGFIPGSEDVKHIRIPSCQDWKDISVPTLLCMGDDLQGHYSFLGNRVDEDNEEDRSRGIEL
GeneID:
221301
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 221301

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM26D (1 products)

Catalog No. Species Pres. Purity   Source  

FAM26D overexpression lysate

FAM26D overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn