TA337607 FAM36A antibody

Rabbit Polyclonal Anti-COX20 Antibody

See related secondary antibodies

Search for all "FAM36A"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Mouse, Rabbit, Rat FAM36A

Product Description for FAM36A

Rabbit anti Equine, Human, Mouse, Rabbit, Rat FAM36A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM36A

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Presentation Purified
Reactivity Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-COX20 antibody: synthetic peptide directed towards the C terminal of human COX20. Synthetic peptide located within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN.
Application WB
Background COX20 is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of COX20 remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM36A (1 products)

Catalog No. Species Pres. Purity   Source  


FAM36A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn