NBP1-90795 FAM48A antibody

See related secondary antibodies

Search for all "FAM48A"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FAM48A

Product Description for FAM48A

Rabbit anti Human FAM48A.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for FAM48A

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NEM7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RSPCNLAIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAGTQYQKTKLTILQSLGDPLYYGKIQPCKADEESDSQMSPSHSSTDD
GeneID:
55578
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 55578

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM48A (1 products)

Catalog No. Species Pres. Purity   Source  

SUPT20H overexpression lysate

SUPT20H overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn