H00120406-B01P FAM55B antibody

See related secondary antibodies

Search for all "FAM55B"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FAM55B

H00120406-B01P

Product Description for FAM55B

Mouse anti Human FAM55B.
Product is tested for Western blot / Immunoblot.

Properties for FAM55B

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ25224
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96DL1
Immunogen:
FAM55B (AAI56725.1, 1 a.a. ~ 365 a.a) full-length human protein.
AA Sequence:
MVEKILIHRILTLFPNAIARKLLLMLTFILIFWIIYLASKDHTKFSFNLENHIILNQGNIFKKYSHSETPLCPAVS PKETELRIKDIMEKLDQQIPPRPFTHVNTTTSATHSTATILNPQDTYCRGDQLDILLEVRDHLGHRKQYGGDFLRA RMYSTALMAGASGKVTDFNNGTYLVSFTLFWEGQVSLSLLLIHPSEGVSALWRARNQGCDRIIFTGLFANRSSNVF TECGLTLNTNAELCQYMDDRDQEAFYCVRPQHMPCEALTHMTTRTRNISYLSKEEWRLFHRSNIGVEMMKNFTPIE VIPCPALFYFIFRDSLTLSPRLECSGMISAHCNLCLPGSSDSPDSASHVAGITSVQRHTWL
GeneID:
120406
Add. information Mouse polyclonal antibody raised against a full-length human FAM55B protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM55B (1 products)

Catalog No. Species Pres. Purity   Source  

Family with sequence similarity 55, member B (FAM55B)

Family with sequence similarity 55, member B (FAM55B) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for FAM55B (1 products)

Catalog No. Species Pres. Purity   Source  

NXPE2 overexpression lysate

NXPE2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn