H00388650-B01P FAM69A antibody

See related secondary antibodies

Search for all "FAM69A"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FAM69A

H00388650-B01P

Product Description for FAM69A

Mouse anti Human FAM69A.
Product is tested for Western blot / Immunoblot.

Properties for FAM69A

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ23493
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T7M9
Immunogen:
FAM69A (NP_001006606.1, 1 a.a. ~ 162 a.a) full-length human protein.
AA Sequence:
MARSLCPGAWLRKPYYLQARFSYVRMKYLFFSWLVVFVGSWIIYVQYSTYTELCRGKDCKKIICDKYKTGVIDGPA CNSLCVTETLYFGKCLSTKPNNQMYLGIWDNLPGVVKCQMEQALHLDFGTELEPRKEIVLFDKPTRGTTVQKFKEM VYSLFKDQHR
GeneID:
388650
Add. information Mouse polyclonal antibody raised against a full-length human FAM69A protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM69A (1 products)

Catalog No. Species Pres. Purity   Source  

FAM69A overexpression lysate

FAM69A overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn