H00138311-B01P FAM69B antibody

See related secondary antibodies

Search for all "FAM69B"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FAM69B

H00138311-B01P

Product Description for FAM69B

Mouse anti Human FAM69B.
Product is tested for Western blot / Immunoblot.

Properties for FAM69B

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C9orf136, MGC20262, pp6977
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VUD6
Immunogen:
FAM69B (NP_689634.1, 1 a.a. ~ 431 a.a) full-length human protein.
AA Sequence:
MRRLRRLAHLVLFCPFSKRLQGRLPGLRVRCIFLAWLGVFAGSWLVYVHYSSYSERCRGHVCQVVICDQYRKGIIS GSVCQDLCELHMVEWRTCLSVAPGQQVYSGLWRDKDVTIKCGIEETLDSKARSDAAPRRELVLFDKPTRGTSIKEF REMTLGFLKANLGDLPSLPALVGQVLLMADFNKDNRVSLAEAKSVWALLQRNEFLLLLSLQEKEHASRLLGYCGDL YLTEGVPHGAWHAAALPPLLRPLLPPALQGALQQWLGPAWPWRAKIAIGLLEFVEELFHGSYGTFYMCETTLANVG YTATYDFKMADLQQVAPEATVRRFLQGRRCEHSTDCTYGRDCRAPCDRLMRQCKGDLIQPNLAKVCALLRGYLLPG APADLREELGTQLRTCTTLSGLASQVEAHHSLVLSHLKTLLWKKISNTKYS
GeneID:
138311
Add. information Mouse polyclonal antibody raised against a full-length human FAM69B protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn