NBP1-56796 FAM98B antibody

See related secondary antibodies

Search for all "FAM98B"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat FAM98B

Product Description for FAM98B

Rabbit anti Human, Mouse, Rat FAM98B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM98B

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ38426
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to FAM98B(family with sequence similarity 98, member B) The peptide sequence was selected from the N terminal of FAM98B. Peptide sequence LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI.
Background The specific function of FAM98B is not yet known.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 283742

Accessory Products

  • LinkedIn