
NBP1-56796 FAM98B antibody

See related secondary antibodies

Search for all "FAM98B"

Quick Overview

Rabbit anti Human, Mouse, Rat FAM98B

Product Description for FAM98B

Rabbit anti Human, Mouse, Rat FAM98B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM98B

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ38426
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to FAM98B(family with sequence similarity 98, member B) The peptide sequence was selected from the N terminal of FAM98B. Peptide sequence LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI.
Background The specific function of FAM98B is not yet known.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 283742

Accessory Products

  • LinkedIn