H00147965-B01P FAM98C antibody

See related secondary antibodies

Search for all "FAM98C"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FAM98C

H00147965-B01P

Product Description for FAM98C

Mouse anti Human FAM98C.
Product is tested for Western blot / Immunoblot.

Properties for FAM98C

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ44669
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q17RN3
Immunogen:
FAM98C (ADR83359.1, 1 a.a. ~ 349 a.a) full-length human protein.
AA Sequence:
MEAVKAEAWEGAAVAQDLLALGYGGVPGAASRGASCPDFRGLCVRLAAELATLGALEQQREAGAEVLSAGDGPGAE EDFLRQLGSLLRELHCPDRALCGGDGAAALREPGAGLRLLRFLCSELQATRLLCLRSLLDPSPRPPLGEGVVEGAG MVQELDLTLQALGLPRPAPGTPASQLLQELHAKISELQPSLPPGSLQPLLSCSLDAPRWEALESLSQSLRDQYRCR RCLLLKRLDLTTSAFHWSDRAEAQGEAMRAVLIPIREVLTPESDISIAHVLAARADLSCLVPATSVAVRRGTCCAI NKVLMGNVPDRGGRPNELEPPMPTWRSRREDGGPQCWGRKKKKKK
GeneID:
147965
Add. information Mouse polyclonal antibody raised against a full-length human FAM98C protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM98C (1 products)

Catalog No. Species Pres. Purity   Source  

FAM98C overexpression lysate

FAM98C overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn