NBP1-56407 FANCA antibody

See related secondary antibodies

Search for all "FANCA"

Quick Overview

Rabbit anti Human FANCA

Product Description for FANCA

Rabbit anti Human FANCA.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for FANCA

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FA, FA1
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to FANCA(Fanconi anemia, complementation group A) The peptide sequence was selected from the N terminal of FANCA. Peptide sequence KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS.
Background The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 2175

Accessory Products

  • LinkedIn