H00084553-B01P FAXC antibody

See related secondary antibodies

Search for all "FAXC"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FAXC

H00084553-B01P

Product Description for FAXC

Mouse anti Human FAXC.
Product is tested for Western blot / Immunoblot.

Properties for FAXC

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C6orf168, dJ273F20
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5TGI0
Immunogen:
FAXC (NP_115900.1, 1 a.a. ~ 409 a.a) full-length human protein.
AA Sequence:
MHWGVGFASSRPCVVDLSWNQSISFFGWWAGSEEPFSFYGDIIAFPLQDYGGIMAGLGSDPWWKKTLYLTGGALLA AAAYLLHELLVIRKQQEIDSKDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKLSAQGKMPWIEY NHEKVSGTEFIIDFLEEKLGVNLNKNLGPHERAISRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSGGGPFSN LLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAMWTLP GTRPERLIKGELINLAMYCERIRRKFWPEWHHDDDNTIYESEESSEGSKTHTPLLDFSFYSRTETFEDEGAENSFS RTPDTDFTGHSLFDSDVDMDDYTDHEQCK
GeneID:
84553
Add. information Mouse polyclonal antibody raised against a full-length human FAXC protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for FAXC (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 6 open reading frame 168 (C6orf168)

Chromosome 6 open reading frame 168 (C6orf168) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn