TA329815 FBXL5 antibody

Rabbit Polyclonal Anti-FBXL5 Antibody

See related secondary antibodies

Search for all "FBXL5"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FBXL5


More Views

  • TA329815

Product Description for FBXL5

Rabbit anti Human FBXL5.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for FBXL5

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms F-box and leucine-rich repeat protein 5, F-box protein FBL4/FBL5, FBL4, FBL5, FLR1, p45SKP2-like protein
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-FBXL5 antibody: synthetic peptide directed towards the middle region of human FBXL5. Synthetic peptide located within the following region: VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES.
Application WB
Background FBXL5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitition. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL5 belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitition. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats. Altertive splicing of this gene generates 2 transcript variants.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for FBXL5 (4 products)

Catalog No. Species Pres. Purity   Source  


FBXL5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


FBXL5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


FBXL5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


FBXL5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FBXL5 (2 products)

Catalog No. Species Pres. Purity   Source  

FBXL5 293T Cell Transient Overexpression Lysate(Denatured)

FBXL5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FBXL5 overexpression lysate

FBXL5 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn