discontinued

H00055336-M01 FBXL8 antibody

See related secondary antibodies

Search for all "FBXL8"

Quick Overview

Mouse anti Human FBXL8 2E1

Product Description for FBXL8

Mouse anti Human FBXL8 2E1.
Presentation: Purified
Product is tested for Enzyme Immunoassay.

Properties for FBXL8

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms F-box and leucine-rich repeat protein 8, F-box protein FBL8, F-box/LRR-repeat protein 8, FBL8
Presentation Purified
Reactivity Hu
Applications E
Clonality Monoclonal
Clone 2E1
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96CD0
Immunogen:
FBXL8 (AAH14414, 1 a.a. ~ 375 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRL EFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDA LVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCAC PEDARASPLPNEAWVALRRRHPGLAVE
GeneID:
55336
Remarks:
Gene Accession: BC014414
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant FBXL8.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 55336

Accessory Products

Proteins and/or Positive Controls

Proteins for FBXL8 (4 products)

Catalog No. Species Pres. Purity   Source  

FBXL8

FBXL8 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

FBXL8

FBXL8 Human in vitro transl.
  Abnova Taiwan Corp.

FBXL8

FBXL8 Human in vitro transl.
  Abnova Taiwan Corp.

FBXL8

FBXL8 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FBXL8 (2 products)

Catalog No. Species Pres. Purity   Source  

FBXL8 293T Cell Transient Overexpression Lysate(Denatured)

FBXL8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FBXL8 overexpression lysate

FBXL8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn