discontinued

H00026268-B01P FBXO9 antibody

See related secondary antibodies

Search for all "FBXO9"

Quick Overview

Mouse anti Human FBXO9

H00026268-B01P

More Views

  • H00026268-B01P

Product Description for FBXO9

Mouse anti Human FBXO9.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for FBXO9

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Cross-immune reaction antigen 1, F-box only protein 9, FBX9, NY-REN-57, VCIA1
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UK97
Immunogen:
FBXO9 (NP_258441.1, 1 a.a. ~ 437 a.a) full-length human protein.
AA Sequence:
MAEAEEDCHSDTVRADDDEENESPAETDLQAQLQMFRAQWMFELAPGVSSSNLENRPCRAARGSLQKTSADTKGKQ EQAKEEKARELFLKAVEEEQNGALYEAIKFYRRAMQLVPDIEFKITYTRSPDGDGVGNSYIEDNDDDSKMADLLSY FQQQLTFQESVLKLCQPELESSQIHISVLPMEVLMYIFRWVVSSDLDLRSLEQLSLVCRGFYICARDPEIWRLACL KVWGRSCIKLVPYTSWREMFLERPRVRFDGVYISKTTYIRQGEQSLDGFYRAWHQVEYYRYIRFFPDGHVMMLTTP EEPQSIVPRLRTRNTRTDAILLGHYRLSQDTDNQTKVFAVITKKKEEKPLDYKYRYFRRVPVQEADQSFHVGLQLC SSGHQRFNKLIWIHHSCHITYKSTGETAVSAFEIDKMYTPLFFARVRSYTAFSERPL
GeneID:
26268
Remarks:
Gene Accession: NM_033480.1
Add. information Mouse polyclonal antibody raised against a full-length human FBXO9 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 26268

Accessory Products

Proteins and/or Positive Controls

Proteins for FBXO9 (4 products)

Catalog No. Species Pres. Purity   Source  

FBXO9

FBXO9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FBXO9

FBXO9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FBXO9

FBXO9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FBXO9

FBXO9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FBXO9 (5 products)

Catalog No. Species Pres. Purity   Source  

FBX09 Lysate

Western Blot: FBX09 Lysate [NBL1-10643] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FBXO9
  Novus Biologicals Inc.

FBXO9 293T Cell Transient Overexpression Lysate(Denatured)

FBXO9 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FBXO9 overexpression lysate

FBXO9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FBXO9 overexpression lysate

FBXO9 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

FBXO9 overexpression lysate

FBXO9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn