H00026226-M15 FBXW4P / SHFM3P1 antibody

See related secondary antibodies

Search for all "FBXW4P / SHFM3P1"

0.1 mg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FBXW4P / SHFM3P1 2C5

H00026226-M15

Product Description for FBXW4P / SHFM3P1

Mouse anti Human FBXW4P / SHFM3P1 2C5.
Presentation: Purified
Product is tested for Enzyme Immunoassay.

Properties for FBXW4P / SHFM3P1

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms F-box and WD-40 domain protein 3, FBW3, FBXW3, split hand/foot malformation (ectrodactyly) type 3 pseudogene 1
Presentation Purified
Reactivity Hu
Applications E
Clonality Monoclonal
Clone 2C5
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
SHFM3P1 (AAF04527, 31 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
EVLLLHMCSYLDMRALGRLAQVYRWLWHFTNCDLLRRQIAWASLNSGFTRLGTNLMTSVPVKVSQNWIVGCCREGI LLKWRCSQMPWMQLEDDALYISQA*
Remarks:
Gene Accession: AF174606
Add. information Mouse monoclonal antibody raised against a partial recombinant SHFM3P1.

Antibody Reactive Against Recombinant Protein.
Application ELISA
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody Reactive Against Recombinant Protein.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn