TA339393 FCER1G antibody

Rabbit Polyclonal Anti-FCER1G Antibody

See related secondary antibodies

Search for all "FCER1G"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat FCER1G

Product Description for FCER1G

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat FCER1G.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FCER1G

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Fc-epsilon RI-gamma, FceRI gamma, High affinity immunoglobulin epsilon receptor subunit gamma, IgE Fc receptor subunit gamma
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-FCER1G antibody: synthetic peptide directed towards the N terminal of human FCER1G. Synthetic peptide located within the following region: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV.
Application WB
Background The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008].
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for FCER1G (3 products)

Catalog No. Species Pres. Purity   Source  


FCER1G Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.


FCER1G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


FCER1G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FCER1G (2 products)

Catalog No. Species Pres. Purity   Source  

FCER1G Lysate

Western Blot: FCER1G Lysate [NBL1-10651] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FCER1G
  Novus Biologicals Inc.

FCER1G overexpression lysate

FCER1G overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn