discontinued

NBP1-84702 FDCSP / C4orf7 antibody

See related secondary antibodies

Search for all "FDCSP / C4orf7"

Quick Overview

Rabbit anti Human FDCSP / C4orf7

Product Description for FDCSP / C4orf7

Rabbit anti Human FDCSP / C4orf7.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for FDCSP / C4orf7

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms FDC secreted protein, FDC-SP, Follicular dendritic cell secreted peptide
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NFU4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPL
GeneID:
260436
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 260436

Accessory Products

Proteins and/or Positive Controls

Proteins for FDCSP / C4orf7 (2 products)

Catalog No. Species Pres. Purity   Source  

FDCSP / C4orf7 (18-85, His-tag)

FDCSP / C4orf7 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

FDCSP / C4orf7 (18-85, His-tag)

FDCSP / C4orf7 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

Positive controls for FDCSP / C4orf7 (1 products)

Catalog No. Species Pres. Purity   Source  

C4orf7 Lysate

Western Blot: C4orf7 Lysate [NBL1-08481] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C4orf7 Protein
  Novus Biologicals Inc.
  • LinkedIn