
NBP1-54840 FECH antibody

See related secondary antibodies

Search for all "FECH"

0.1 mg / €360.00

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat FECH

Product Description for FECH

Rabbit anti Canine, Human, Mouse, Rat FECH.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FECH

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms EPP, FCE
Presentation Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to FECH(ferrochelatase (protoporphyria)) The peptide sequence was selected from the N terminal of FECH. Peptide sequence LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM.
Background Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria.Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 2235

Accessory Products

  • LinkedIn