discontinued

H00010116-B01 FEM1B antibody

See related secondary antibodies

Search for all "FEM1B"

Quick Overview

Mouse anti Human FEM1B

Product Description for FEM1B

Mouse anti Human FEM1B.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for FEM1B

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms F1A-alpha, F1AA, FEM1-beta, Fem-1-like death receptor-binding protein alpha, KIAA0396, Protein fem-1 homolog B
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UK73
Immunogen:
FEM1B (NP_056137, 1 a.a. ~ 627 a.a) full-length human protein.
AA Sequence:
MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAKVVRLLLEHYRVQTQQT GTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVTNSTPLRAACFDGRLDIVKYLVENNANISIANK YDNTCLMIAAYKGHTDVVRYLLEQRADPNAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKVAAE SCKADVVELLLSHADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIHAYGN RTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIYRGAVYADNMEFEQCIKLWLHALHLRQKGNRN THKDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTK TQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHLAVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEG NSALHIIVQYNRPISDFLTLHSIIISLVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARAVRAN DINYQDQIPRTLEEFVGFH
GeneID:
10116
Remarks:
Gene Accession: NM_015322
Add. information Mouse polyclonal antibody raised against a full-length human FEM1B protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 10116

Accessory Products

Proteins and/or Positive Controls

Proteins for FEM1B (5 products)

Catalog No. Species Pres. Purity   Source  

FEM1B

FEM1B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

FEM1B

FEM1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FEM1B

FEM1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FEM1B

FEM1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FEM1B

FEM1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FEM1B (3 products)

Catalog No. Species Pres. Purity   Source  

FEM1B 293T Cell Transient Overexpression Lysate(Denatured)

FEM1B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FEM1B Lysate

Western Blot: FEM1B Lysate [NBL1-10674] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FEM1B
  Novus Biologicals Inc.

FEM1B overexpression lysate

FEM1B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn