TA335598 FEM1B antibody

Rabbit Polyclonal Anti-FEM1B Antibody

See related secondary antibodies

Search for all "FEM1B"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat FEM1B


More Views

  • TA335598
  • TA335598

Product Description for FEM1B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat FEM1B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FEM1B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms F1A-alpha, F1AA, FEM1-beta, Fem-1-like death receptor-binding protein alpha, KIAA0396, Protein fem-1 homolog B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-FEM1B Antibody: synthetic peptide directed towards the C terminal of human FEM1B. Synthetic peptide located within the following region: DKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH.
Application WB
Background FEM1B is a component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. It involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. FEM1B also involved in glucose homeostasis in pancreatic islet.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for FEM1B (5 products)

Catalog No. Species Pres. Purity   Source  


FEM1B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.


FEM1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


FEM1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


FEM1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


FEM1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FEM1B (3 products)

Catalog No. Species Pres. Purity   Source  

FEM1B 293T Cell Transient Overexpression Lysate(Denatured)

FEM1B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FEM1B Lysate

Western Blot: FEM1B Lysate [NBL1-10674] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FEM1B
  Novus Biologicals Inc.

FEM1B overexpression lysate

FEM1B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn