discontinued

H00152273-B01P FGD5 antibody

See related secondary antibodies

Search for all "FGD5"

Quick Overview

Mouse anti Human FGD5

Product Description for FGD5

Mouse anti Human FGD5.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for FGD5

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms FYVE, RhoGEF and PH domain-containing protein 5, ZFYVE23, Zinc finger FYVE domain-containing protein 23
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZNL6
Immunogen:
FGD5 (AAH35364.1, 1 a.a. ~ 540 a.a) full-length human protein.
AA Sequence:
MRALDDMDHEGRDTLAREELRQGLSELPAIHDLHQGILEELEERLSNWESQQKVADVFLAREQGFDHHATHILQFD RYLGLLSENCLHSPRLAAAVREFEQSVQGGSQTAKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALSLI SKVTDRANDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMNDVLLYTYPQKDGK YRLKNTLAVANMKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYGCLSRALPEDYKAQALAAFHHSVEIRE RLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKK RGRAVPGLMRERPVSMSFPLSSPRFSGSAFSSVFQSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCKRGKR HWKKLWFVIKGKVLYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYSFKAEDTNSAQRWIE AMEDASVL
GeneID:
152273
Remarks:
Gene Accession: BC035364.1
Add. information Mouse polyclonal antibody raised against a full-length human FGD5 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human
Gene ID 152273

Accessory Products

Proteins and/or Positive Controls

Proteins for FGD5 (2 products)

Catalog No. Species Pres. Purity   Source  

FGD5

FGD5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FGD5

FGD5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FGD5 (2 products)

Catalog No. Species Pres. Purity   Source  

FGD5 293T Cell Transient Overexpression Lysate(Denatured)

FGD5 293T Cell Transient Overexpression Lysate(Denatured) Transient overexpression cell lysate was tested with Anti-FGD5 antibody (H00152273-B01) by Western Blots.
  Abnova Taiwan Corp.

FGD5 overexpression lysate

FGD5 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn