TA337310 FGD5 antibody

Rabbit Polyclonal Anti-FGD5 Antibody

See related secondary antibodies

Search for all "FGD5"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Rat FGD5

Product Description for FGD5

Rabbit anti Canine, Equine, Human, Mouse, Rat FGD5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FGD5

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms FYVE, RhoGEF and PH domain-containing protein 5, ZFYVE23, Zinc finger FYVE domain-containing protein 23
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-FGD5 antibody is: synthetic peptide directed towards the C-terminal region of Human FGD5. Synthetic peptide located within the following region: FVIKGKVLYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHK.
Application WB
Background FGD5 activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. It mediates VEGF-induced CDC42 activation. It may regulate proangiogenic action of VEGF in vascular endothelial cells, including network formation, directiol movement and proliferation and may play a role in regulating the actin cytoskeleton and cell shape.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for FGD5 (2 products)

Catalog No. Species Pres. Purity   Source  


FGD5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


FGD5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FGD5 (2 products)

Catalog No. Species Pres. Purity   Source  

FGD5 293T Cell Transient Overexpression Lysate(Denatured)

FGD5 293T Cell Transient Overexpression Lysate(Denatured) Transient overexpression cell lysate was tested with Anti-FGD5 antibody (H00152273-B01) by Western Blots.
  Abnova Taiwan Corp.

FGD5 overexpression lysate

FGD5 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn