TA333576 FGF13 antibody

Rabbit Polyclonal Anti-FGF13 Antibody

See related secondary antibodies

Search for all "FGF13"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish FGF13

TA333576

More Views

  • TA333576
  • TA333576

Product Description for FGF13

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish FGF13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FGF13

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms FGF-13, FHF2, Fibroblast growth factor 13, Fibroblast growth factor homologous factor 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92913
Immunogen:
The immunogen for Anti-FGF13 Antibody: synthetic peptide directed towards the middle region of human FGF13. Synthetic peptide located within the following region: PKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST.
GeneID:
2258
Application WB
Background The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region. Altertive splicing of this gene at the 5' end results in several transcript variants encoding different isoforms with different N-termini.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FGF13 (3 products)

Catalog No. Species Pres. Purity   Source  

FGF13 (transcript variant 6)

FGF13 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

FGF13

FGF13 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FGF13

FGF13 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FGF13 (4 products)

Catalog No. Species Pres. Purity   Source  

FGF13 293T Cell Transient Overexpression Lysate(Denatured)

FGF13 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FGF13 Lysate

Western Blot: FGF13 Lysate [NBL1-10689] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FGF13
  Novus Biologicals Inc.

FGF13 overexpression lysate

FGF13 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FGF13 overexpression lysate

FGF13 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn