
NBP1-69287 Fibrinogen gamma chain antibody

See related secondary antibodies

Search for all "Fibrinogen gamma chain"

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat Fibrinogen gamma chain

Product Description for Fibrinogen gamma chain

Rabbit anti Canine, Human, Mouse, Rat Fibrinogen gamma chain.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Fibrinogen gamma chain

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to FGG(fibrinogen gamma chain) The peptide sequence was selected from the middle region of FGG. Peptide sequence RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG.
Background FGG is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia.The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 2266

Accessory Products

  • LinkedIn