discontinued

H00002288-M01 FKBP4 antibody

See related secondary antibodies

Search for all "FKBP4"

Quick Overview

Mouse anti Human, Mouse, Rat FKBP4 5C11

H00002288-M01

More Views

  • H00002288-M01
  • H00002288-M01
  • H00002288-M01
  • H00002288-M01
  • H00002288-M01

Product Description for FKBP4

Mouse anti Human, Mouse, Rat FKBP4 5C11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for FKBP4

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms 52 kDa FK506-binding protein, FK506-binding protein 4, FKBP52 protein, FKBP59, HBI, HSP-binding immunophilin, PPIase, Peptidyl-prolyl cis-trans isomerase, Rotamase, p59 protein
Presentation Purified
Reactivity Hu, Ms, Rt
Applications E, P, WB
Clonality Monoclonal
Clone 5C11
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q02790
Immunogen:
FKBP4 (AAH07924, 301 a.a. ~ 411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADF QKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL*
GeneID:
2288
Remarks:
Gene Accession: BC007924
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant FKBP4.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse,Rat
Gene ID 2288

Accessory Products

Proteins and/or Positive Controls

Proteins for FKBP4 (9 products)

Catalog No. Species Pres. Purity   Source  

FKBP4

FKBP4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

FKBP4 (1-459, His-tag)

FKBP4, 1-459aa human, His-tagged, recombinant, E.coli: 
15% SDS-PAGE (3 µg) Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €540.00
  OriGene Technologies GmbH

FKBP4 (1-459, His-tag)

FKBP4, 1-459aa human, His-tagged, recombinant, E.coli: 
15% SDS-PAGE (3 µg) Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €230.00
  OriGene Technologies GmbH

FKBP4

FKBP4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FKBP4

FKBP4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FKBP4

FKBP4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FKBP4

FKBP4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FKBP4

FKBP4 Human
  Abnova Taiwan Corp.

FKBP4

SDS-Page: FKBP4/FKBP52 Protein [NBC1-22936] - FKBP4, 53.9 kDa (479 aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for FKBP4 (3 products)

Catalog No. Species Pres. Purity   Source  

FKBP4 293T Cell Transient Overexpression Lysate(Denatured)

FKBP4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FKBP4/FKBP52 Lysate

Western Blot: FKBP4/FKBP52 Lysate [NBL1-10738] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FKBP4
  Novus Biologicals Inc.

FKBP4 overexpression lysate

FKBP4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn